PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01322.1.g00170.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 237aa    MW: 26424.7 Da    PI: 6.3054
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01322.1.g00170.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox597.9e-1961114356
                                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                     k++++++eq + Le  F+k+r++ + ++ +LA++lgL+ +qV vWFqNrRa++k
  Zpz_sc01322.1.g00170.1.sm.mkhc  61 KKRRLSDEQARLLEMSFRKERKLETPRKVQLAAELGLDAKQVAVWFQNRRARHK 114
                                     56689***********************************************99 PP

2HD-ZIP_I/II111.94.2e-3661152293
                     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerL 80 
                                     kkrrls+eq++lLE+sF++e+kLe+ rKv+la eLgl+++qvavWFqnrRAR+k+k +E+++++L++a+da++ +n++L
  Zpz_sc01322.1.g00170.1.sm.mkhc  61 KKRRLSDEQARLLEMSFRKERKLETPRKVQLAAELGLDAKQVAVWFQNRRARHKSKLMEEEFAKLRAAHDAVVLRNCHL 139
                                     9****************************************************************************** PP

                     HD-ZIP_I/II  81 ekeveeLreelke 93 
                                     ++e+ +L+++l+e
  Zpz_sc01322.1.g00170.1.sm.mkhc 140 QTEMLKLEDRLAE 152
                                     ********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.90856116IPR001356Homeobox domain
SMARTSM003894.6E-1659120IPR001356Homeobox domain
SuperFamilySSF466891.37E-1660122IPR009057Homeodomain-like
CDDcd000863.27E-1561116No hitNo description
Gene3DG3DSA:1.10.10.606.1E-1761114IPR009057Homeodomain-like
PfamPF000463.1E-1661114IPR001356Homeobox domain
PRINTSPR000315.3E-68796IPR000047Helix-turn-helix motif
PROSITE patternPS00027091114IPR017970Homeobox, conserved site
PRINTSPR000315.3E-696112IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MGCEGEERML FPSSFAFVPA ESFAEAADTS GSSGEQKKAR QRRRRKPKPA PEDQAGDEQA  60
KKRRLSDEQA RLLEMSFRKE RKLETPRKVQ LAAELGLDAK QVAVWFQNRR ARHKSKLMEE  120
EFAKLRAAHD AVVLRNCHLQ TEMLKLEDRL AEAEEEKKKL ITAAAAAAAA TGAADTSSPS  180
SSSFSTVTCN PAALLGQQFG VEDEVADFSY MSQYAYNDYL MDFAACYFGG VVYDQFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14363RRKPKPAPEDQAGDEQAKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985327.11e-100PREDICTED: homeobox-leucine zipper protein HOX12-like
SwissprotA2XDK52e-84HOX12_ORYSI; Homeobox-leucine zipper protein HOX12
TrEMBLK4AEE81e-100K4AEE8_SETIT; Uncharacterized protein
STRINGSi037255m2e-99(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP200638101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.13e-30homeobox protein 40